Host taxon 10090
Protein NP_954610.1
taste receptor type 2 member 135
Mus musculus
Gene Tas2r135, UniProt Q7TQA9
>NP_954610.1|Pseudomona aeruginosa PA01|taste receptor type 2 member 135
MGPIMSTGEMSTGHTVLGCQTTDKTVVTLFIILVLLCLVAVVGNGFIIIALGMKWLLRRTLSAHNKLLISLAASRFCLQCVVIGKNIYVFLNPTSFPYNPVIQLLNLMWDFLTAATIWLCSLLGFFYCVKIATLTHPVFVWLKYRLPGWVPWMLLSAVGMSSLTSILCFIGNYMIYQNHAKSGHQPWNVTGNSLRHSLEKFYFFSIKIIMWTIPTVVFSIFMSLLLVSLVRHMKKTFLALSELRDVWAQAHFKALLPLLSFIVLFISCFLTLVLSSASNTPYQEFRYWMWQVVIHLCTVIHPIVILFSNPVLRVVIKRGCC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.36 | 2.35859873880762 | 0.0003 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)