Bacterial taxon 208964
Protein WP_003100766.1
T3SS regulon translocated regulator ExsE
Pseudomona aeruginosa PA01
Gene exsE, UniProt Q9I322
>WP_003100766.1|Pseudomona aeruginosa PA01|T3SS regulon translocated regulator ExsE
MKIESISPVQPSQDAGAEAVGHFEGRSVTRAAVRGEDRSSVAGLARWLARNVAGDPRSEQALQRLADGDGTPLEARTVRRR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●○○○ 1.9 | 1.90216727282846 | 2.0e-37 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)