Host taxon 10090
Protein NP_033980.1
T-cell surface glycoprotein CD3 gamma chain precursor
Mus musculus
Gene Cd3g, UniProt P11942
>NP_033980.1|Pseudomona aeruginosa PA01|T-cell surface glycoprotein CD3 gamma chain precursor
MEQRKGLAGLFLVISLLQGTVAQTNKAKNLVQVDGSRGDGSVLLTCGLTDKTIKWLKDGSIISPLNATKNTWNLGNNAKDPRGTYQCQGAKETSNPLQVYYRMCENCIELNIGTISGFIFAEVISIFFLALGVYLIAGQDGVRQSRASDKQTLLQNEQLYQPLKDREYDQYSHLQGNQLRKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.09 | -2.08659595666072 | 0.02 | 32071273 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)