Host taxon 10090
Protein NP_038515.3
T-cell surface glycoprotein CD3 delta chain precursor
Mus musculus
Gene Cd3d, UniProt P04235
>NP_038515.3|Pseudomona aeruginosa PA01|T-cell surface glycoprotein CD3 delta chain precursor
MEHSGILASLILIAVLPQGSPFKIQVTEYEDKVFVTCNTSVMHLDGTVEGWFAKNKTLNLGKGVLDPRGIYLCNGTEQLAKVVSSVQVHYRMCQNCVELDSGTMAGVIFIDLIATLLLALGVYCFAGHETGRPSGAAEVQALLKNEQLYQPLRDREDTQYSRLGGNWPRNKKS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.66 | 1.66003833960108 | 0.0023 | 32071273 | |
Retrieved 1 of 4 entries in 1 ms
(Link to these results)