Host taxon 10090
Protein NP_598747.1
T-cell leukemia translocation-altered gene protein homolog isoform 1
Mus musculus
Gene Tcta, UniProt Q8VEA7
>NP_598747.1|Pseudomona aeruginosa PA01|T-cell leukemia translocation-altered gene protein homolog isoform 1
MAEPWAGQFLQALPATVLGALGTLGSDFLREWETQDMRVTLFKLLLLWLVLSLLGIQLAWGFYGNTVTGLYHRPDPHPQPPAAMGVFLPPGLGGQNGSTPDGSTHFSSWEIAANEALKTHRE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.84 | -1.84345406795985 | 1.5e-13 | 32071273 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)