Host taxon 10090
Protein NP_001296743.1
synaptojanin-2-binding protein isoform 2
Mus musculus
Gene Synj2bp, UniProt Q9D6K5
>NP_001296743.1|Pseudomona aeruginosa PA01|synaptojanin-2-binding protein isoform 2
MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKEDGAAAQDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGCAVSLRVQHRVGITCTWIWDSRLLHCSCE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.19 | -1.19425830089076 | 7.9e-13 | 32071273 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)