Host taxon 10090
Protein NP_033330.1
synaptogyrin-2
Mus musculus
Gene Syngr2, UniProt O55101
>NP_033330.1|Pseudomona aeruginosa PA01|synaptogyrin-2
MESGAYGAANAGGSFDLRRFLSQPQVVTRLVSMVLALIVFSCIFGEGYTNIHTSDQLYCVFNQNEDACRYGSAIGVLAFLASAFFLVVDAFFSQISNATDRKYLVIGDLLFSALWTFLWFVGFCFLTNQWAATKPQDVRVGADSARAAITFSFFSIFSWGVLASLAYQRYKAGVDAFIQNYVDPTPDPNTAYASYPSASVENYQQPPFTQNVETTEGYQPPPVY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.38 | 0.376071471301993 | 0.0082 | 32071273 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)