Host taxon 10090
Protein NP_001020779.1
SUZ domain-containing protein 1 isoform 1
Mus musculus
Gene Szrd1, UniProt Q6NXN1
>NP_001020779.1|Pseudomona aeruginosa PA01|SUZ domain-containing protein 1 isoform 1
MEDEEVAESWEEAADSGEIDRRLEKKLKITQKESRKSKSPPKVPIVIQDDSLPTGPPPQIRILKRPTSNGVVSSPNSTSRPALPVKSLAQREAEYAEARRRILGSASPEEEQEKPILDRPTRISQPEDSRQPSNVIRQPLGPDGSQGFKQRR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.38 | 0.383097007487655 | 0.00032 | 32071273 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)