Host taxon 10090
Protein NP_001156666.1
surfactant-associated protein 2 precursor
Mus musculus
Gene Sfta2, UniProt E9PXB6
>NP_001156666.1|Pseudomona aeruginosa PA01|surfactant-associated protein 2 precursor
MESLMRLFLLLALLSSSHAGPKVTLQVKLTETFQDKTSQNSSALDMLQKICLLLHLPSGTNVTLLHKGPPHYLTCRA
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 6.55 | 6.5529143806171 | 3.1e-5 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)