Bacterial taxon 208964
Protein WP_003090389.1
sulfurtransferase complex subunit TusC
Pseudomona aeruginosa PA01
Gene tusC, UniProt Q9I0N2
>WP_003090389.1|Pseudomona aeruginosa PA01|sulfurtransferase complex subunit TusC
MSQSLLIISRQSPWSGPSAREALDIALAGGAFDLPVGMLFLDDGAFQLAPGQHPAHLQQKDLQANLQALPMFGVDDLYVSARSLRERGLAEERLALAVEVLDDQALRDLLQRYDQVITL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●○○○ -1.16 | -1.16067228831508 | 7.9e-10 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)