Host taxon 10090
Protein NP_083964.2
sulfiredoxin-1
Mus musculus
Gene Srxn1, UniProt Q9D975
>NP_083964.2|Pseudomona aeruginosa PA01|sulfiredoxin-1
MVQPGLVKRPGGTGHQGRGMGLRAGGALRRAGAGPGAPEGQGPGGAQGGSIHSGCIATVHNVPIAVLIRPLPSVLDPAKVQSLVDTILADPDSVPPIDVLWIKGAQGGDYYYSFGGCHRYAAYQQLQRETIPAKLVRSTLSDLRMYLGASTPDLQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.27 | 2.27450677601731 | 3.0e-74 | 32071273 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)