Host taxon 10090
Protein NP_075863.2
succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial isoform 1 precursor
Mus musculus
Gene Sdhb, UniProt Q9CQA3
>NP_075863.2|Pseudomona aeruginosa PA01|succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial isoform 1 precursor
MAATVGVSLKRGFPAAVLGRVGLQFQACRGAQTAAAAAPRIKKFAIYRWDPDKTGDKPRMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTDLSKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEDREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSVYRCHTIMNCTQTCPKGLNPGKAIAEIKKMMATYKEKRALA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.39 | -0.385869702220407 | 0.031 | 32071273 | |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)