Host taxon 10090
Protein NP_080779.2
succinate dehydrogenase assembly factor 4, mitochondrial precursor
Mus musculus
Gene Sdhaf4, UniProt Q8BTE0
>NP_080779.2|Pseudomona aeruginosa PA01|succinate dehydrogenase assembly factor 4, mitochondrial precursor
MVSTTLSVSRMTFVWRAARPSLLNHSLRKMSYQEGKPEPAKQALKKSKLPLGRFDSLEDSPEEREPLQKFPDDVNPVTKEKGGPKGPEPTRYGDWERKGRCIDF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.47 | -1.47085505896841 | 0.028 | 32071273 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)