Host taxon 10090
Protein NP_001071181.1
succinate dehydrogenase assembly factor 3, mitochondrial precursor
Mus musculus
Gene Sdhaf3, UniProt Q8BQU3
>NP_001071181.1|Pseudomona aeruginosa PA01|succinate dehydrogenase assembly factor 3, mitochondrial precursor
MPGKHVSRVRALYRRILLLHRALPPDLKALGDQYVKDEFRRHKTVGPGEAQRFLKEWETYAAVLWQQAEDSRQSSTGKACFGTSLPEEKLNDFRDEQIGQLQELMQEATKPNRQFSITESTKPQL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.85 | -2.84559207858703 | 0.013 | 32071273 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)