Host taxon 10090
Protein NP_083696.2
structure-specific endonuclease subunit SLX1
Mus musculus
Gene Slx1b, UniProt Q8BX32
>NP_083696.2|Pseudomona aeruginosa PA01|structure-specific endonuclease subunit SLX1
MDHAARPGRFFGVYLLYCQNPRHRGRVYVGFTVNPARRVRQHNAGRKKGGAWRTSGRGPWDMVLIIHGFPSAVAALRFEWAWQHPQASRRLTHVGPRLRSEAAFAFHLRVLAHMLRVPPWVRLPLTLRWLRPDFRHELCPAPPAHMPIAFGPPPPQPLVPKRPAVSEADSERQLDLGTKARCSLCARLLQDEEGPLCCPHPGCPLRAHIICLAEEFLQEEPGQLLPLEGHCPSCKKSLLWGNLVGQCHADTEEEEDLELEEEHWTDLLET
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.62 | -2.62003268735248 | 1.5e-7 | 32071273 | |
Retrieved 1 of 2 entries in 0.6 ms
(Link to these results)