Host taxon 10090
Protein NP_071719.1
stromal cell-derived factor 2-like protein 1 precursor
Mus musculus
Gene Sdf2l1, UniProt Q9ESP1
>NP_071719.1|Pseudomona aeruginosa PA01|stromal cell-derived factor 2-like protein 1 precursor
MWGASRGRVAGPTLLGLLLALSVRSGGASKASAGLVTCGSVLKLLNTHHKVRLHSHDIKYGSGSGQQSVTGVEESDDANSYWRIRGGSEGGCPRGLPVRCGQAVRLTHVLTGKNLHTHHFPSPLSNNQEVSAFGEDGEGDDLDLWTVRCSGQHWEREASVRFQHVGTSVFLSVTGEQYGNPIRGQHEVHGMPSANAHNTWKAMEGIFIKPGADLSTGHDEL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.44 | -1.44179148142398 | 0.00027 | 32071273 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)