Host taxon 10090
Protein NP_038683.1
stromal cell-derived factor 1 isoform beta precursor
Mus musculus
Gene Cxcl12, UniProt P40224
>NP_038683.1|Pseudomona aeruginosa PA01|stromal cell-derived factor 1 isoform beta precursor
MDAKVVAVLALVLAALCISDGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRLKM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.64 | -2.63858173749753 | 3.2e-191 | 32071273 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)