Host taxon 10090
Protein NP_109610.1
stress-associated endoplasmic reticulum protein 1
Mus musculus
Gene Serp1, UniProt Q9Z1W5
>NP_109610.1|Pseudomona aeruginosa PA01|stress-associated endoplasmic reticulum protein 1
MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRMGM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.59 | 0.586035609723577 | 3.4e-12 | 32071273 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)