Host taxon 10090
Protein NP_796199.1
sterile alpha motif domain-containing protein 12
Mus musculus
Gene Samd12, UniProt Q0VE29
>NP_796199.1|Pseudomona aeruginosa PA01|sterile alpha motif domain-containing protein 12
MAVEALHCGLNPRGIDHSAHADGIKLQIEGEGVESQSIKNRTFQKVPDQKGTPKRLQGEAETAKSATVKLSKPVALWTQQDVCKWLKKHCPNQYQLYSESFKQHDITGRALLRLTDKKLERMGIAQENQRQHILQQVLQLKVREEVRNLQLLTQASVECSP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.9 | -2.8957294704433 | 5.4e-7 | 32071273 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)