Host taxon 10090
Protein NP_079564.1
stefin-3
Mus musculus
Gene Stfa3, UniProt P35173
>NP_079564.1|Pseudomona aeruginosa PA01|stefin-3
MSQENLKIKGGLSEARPATPEIQMIADKVRPLLEEQTNEKYEKFEAVEYKSQVVAGQNLFIKIDVGNGCFLHMKVFRGLSGEDDLKLKGYQTNKTKTDELTSM
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 6,5 | 6.49721047232677 | 3,2e-8 | 32071273 | |
Retrieved 1 of 1 entries in 0,8 ms
(Link to these results)