Host taxon 10090
Protein NP_001076014.1
stefin-2
Mus musculus
Gene Stfa2, UniProt P35174
>NP_001076014.1|Pseudomona aeruginosa PA01|stefin-2
MTEYTIEIIGGLSEARPATSEIQEIADKVRPLLEEKTNEKYEKFKAIEYKVQVVQGLNYFIKMNVGRGCYLHINVLSGISSENDLELTGYQTNKAKNDELTYF
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 6,63 | 6.63147522015542 | 3,1e-16 | 32071273 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)