Host taxon 10090
Protein NP_001076012.1
stefin-1
Mus musculus
Gene Stfa1, UniProt P35175
>NP_001076012.1|Pseudomona aeruginosa PA01|stefin-1
MSLGGVSEASRATPEIQMIANKVRPQLEAKTNKKYEKFEAVEYKTQVVAGENIFIKMDVGHGCFIHIKVFNGPTGKDNYELHGYQTDKTMDEELTYF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 4.96 | 4.95782053820541 | 0.026 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)