Host taxon 10090
Protein NP_001001332.2
stefin A1-like protein
Mus musculus
Gene Cstdc6, UniProt L7N257
>NP_001001332.2|Pseudomona aeruginosa PA01|stefin A1-like protein
MYGGVSEAKPATPEIQKIADKVRSQLEAKTNKKYEKFEAVEYKTQAVAGENIFIKMDVGHGCFIHIKVFSGPTGKDNYELHGYQTDKAKDDELTYF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 7.49 | 7.48851127486831 | 9.7e-8 | 32071273 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)