Host taxon 10090
Protein NP_062615.1
stathmin
Mus musculus
Gene Stmn1, UniProt P54227
>NP_062615.1|Pseudomona aeruginosa PA01|stathmin
MASSDIQVKELEKRASGQAFELILSPRSKESVPDFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHVEEVRKNKESKDPADETEAD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.1 | -2.10365732674302 | 1.6e-23 | 32071273 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)