Host taxon 10090
Protein NP_001297532.1
SPRY domain-containing protein 7 isoform 2
Mus musculus
Gene Spryd7, UniProt Q3TFQ1
>NP_001297532.1|Pseudomona aeruginosa PA01|SPRY domain-containing protein 7 isoform 2
MAASAWCCLRCCRDGGTGHIPLKEMPAVQLDTQHMGTDVVIVKNGRRICGTGGCLASAPLHQNKSYFEFKIQSTGIWGIGVATQKVNLNQIPLGRDMHSLVMRNDGALYHNNEEKNRLPANSLPQEGDVVLTTVQFWIASSVNFIILLHLVLKKYYSSSRSSE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.48 | 1.48138942689491 | 4.7e-11 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)