Host taxon 10090
Protein NP_079599.1
splicing factor 3B subunit 6
Mus musculus
Gene Sf3b6, UniProt P59708
>NP_079599.1|Pseudomona aeruginosa PA01|splicing factor 3B subunit 6
MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.75 | 0.748423674983094 | 0.0003 | 32071273 | |
Retrieved 1 of 1 entries in 2.1 ms
(Link to these results)