Host taxon 10090
Protein NP_081917.1
sperm flagellar protein 1
Mus musculus
Gene Spef1, UniProt Q99JL1
>NP_081917.1|Pseudomona aeruginosa PA01|sperm flagellar protein 1
MESSVDEEALHQLYLWVDNIPLSRPKRNLSRDFSDGVLVAELIKFYFPKMVEMHNYVPANSLQQKLSNWGHLNRKVLNKLNFSVPDDVMRKIAQCSPGVVELVLIPLRQRLEERQRRQKLGVGSLQELAPQDSSGYMDMGLPQKVRGEGAPALGEQLREGRPLASRPPGYNQALQGDPSFVLQIAEKEQELLASQETVQVLQMKVKRLEHLLQLKNVRIDDLSRRLQQAERKQR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.9 | -0.90171451352087 | 0.0032 | 32071273 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)