Host taxon 10090
Protein NP_001297477.1
SOSS complex subunit B2 isoform b
Mus musculus
Gene Nabp1, UniProt Q8BGW5
>NP_001297477.1|Pseudomona aeruginosa PA01|SOSS complex subunit B2 isoform b
MWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYRGQQNRGVQNEQKDKLSTNTFGPVGNGDQTGPESRGYHLPYGRSNGPGPISPQLPGTPSSQTVRTTISNARDPRRAFKR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.04 | 2.04468765545611 | 1.7e-87 | 32071273 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)