Host taxon 10090
Protein NP_001020783.1
sorting nexin-22 isoform 1
Mus musculus
Gene Snx22, UniProt Q8C084
>NP_001020783.1|Pseudomona aeruginosa PA01|sorting nexin-22 isoform 1
MLEVHIPSVGPEAEGPRQSPEKGHMVFQVEVLYSGRRHTVPRRYSEFHALHKRIKKRYKVPDFPSKRLPNWRTRGLEQRRQGLETYIQGILYLNQDVPKELLEFLRLRHFPTDSKTSSWSTLGEFLPSDTSSQLHHRPVIGFCMDPYVCTPSPEPLPEVVVDGVLQGLYGFSTSPVPAQPEANCHPAPSLVP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.57 | -1.57093383775905 | 0.0015 | 32071273 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)