Host taxon 10090
Protein NP_061363.2
sorting nexin-12 isoform 3
Mus musculus
Gene Snx12, UniProt O70493
>NP_061363.2|Pseudomona aeruginosa PA01|sorting nexin-12 isoform 3
MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKVLGEKDC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.2 | -1.2009961272846 | 3.3e-11 | 32071273 | |
Retrieved 1 of 4 entries in 0.4 ms
(Link to these results)