Host taxon 10090
Protein NP_766162.2
solute carrier family 66 member 3 isoform 1 precursor
Mus musculus
Gene Pqlc3, UniProt Q3UU83
>NP_766162.2|Pseudomona aeruginosa PA01|solute carrier family 66 member 3 isoform 1 precursor
MEAGLLWFCNWSTLGVCAALKLPQIYAQLAARSARGISLPSLLLELAGFLVFLRYQHYYGNPLLTYLEYPILIAQDIVLLLFVFHFNGNVKQALPYMAVFVSSWFILSLQKWIIDLAMNLCTVISAASKFAQLQYLWKVQDSGAVSALTWGLSAYTCATRIITTLMTTNDLTILIRFVIMLALNIWVTATVLHYRKSATKAE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.94 | 0.941586587008493 | 3.5e-7 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)