Host taxon 10090
Protein NP_598615.1
SNARE-associated protein Snapin
Mus musculus
Gene Snapin, UniProt Q9Z266
>NP_598615.1|Pseudomona aeruginosa PA01|SNARE-associated protein Snapin
MAAAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGVYPPGSPSK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.56 | -1.56179990152618 | 3.2e-12 | 32071273 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)