Host taxon 10090
Protein NP_033486.1
small ubiquitin-related modifier 1 precursor
Mus musculus
Gene Sumo1, UniProt P63166
>NP_033486.1|Pseudomona aeruginosa PA01|small ubiquitin-related modifier 1 precursor
MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.02 | 1.02422465961954 | 0.025 | 32071273 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)