Host taxon 10090
Protein NP_033252.1
small nuclear ribonucleoprotein Sm D1
Mus musculus
Gene Snrpd1, UniProt P62315
>NP_033252.1|Pseudomona aeruginosa PA01|small nuclear ribonucleoprotein Sm D1
MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.48 | 1.48267022315801 | 0.0011 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)