Host taxon 10090
Protein NP_080782.1
small nuclear ribonucleoprotein G
Mus musculus
Gene Snrpg, UniProt P62309
>NP_080782.1|Pseudomona aeruginosa PA01|small nuclear ribonucleoprotein G
MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.35 | -1.34611933599254 | 0.015 | 32071273 | |
Retrieved 1 of 1 entries in 2.3 ms
(Link to these results)