Host taxon 10090
Protein NP_001317684.1
small integral membrane protein 8
Mus musculus
Gene Smim8, UniProt Q9CQQ0
>NP_001317684.1|Pseudomona aeruginosa PA01|small integral membrane protein 8
MSSAPDPPTVKKEPLKEKNFENPGLRGAHTTTLFRAVNPELFIKPNKPVMAFGLVTLSLCVAYIGYLHATQENRKDLYEAIDSEGHRYMRRKTSKWD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.27 | -2.2712796181722 | 0.0006 | 32071273 | |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)