Host taxon 10090
Protein NP_765984.1
small integral membrane protein 7 precursor
Mus musculus
Gene Smim7, UniProt Q5RKS2
>NP_765984.1|Pseudomona aeruginosa PA01|small integral membrane protein 7 precursor
MIGDILLFGTLLMNAGAVLNFKLKKKDTQGFGEESKEPSTGDNIREFLLSLRYFRIFIALWNVFMMLCMIVLFGS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.81 | 0.805913669039903 | 1.7e-8 | 32071273 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)