Host taxon 10090
Protein NP_001012685.2
small integral membrane protein 19 isoform 1
Mus musculus
Gene Smim19, UniProt Q80ZU4
>NP_001012685.2|Pseudomona aeruginosa PA01|small integral membrane protein 19 isoform 1
MLEVPMAGSYGVMADDGSIDYTVHEAWNEATNVYLIVILVSFGLFMYAKRNKRKIMRIFSVPPTEGMLSEPSFYDTVSRIRLRQQVEAHPVSRKYEYQQPQSQADSVQLSLE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.82 | -0.815162595427041 | 0.033 | 32071273 | |
Retrieved 1 of 2 entries in 0.5 ms
(Link to these results)