Host taxon 10090
Protein NP_001041715.1
small integral membrane protein 15
Mus musculus
Gene Smim15, UniProt Q3UTD9
>NP_001041715.1|Pseudomona aeruginosa PA01|small integral membrane protein 15
MLDIKAWAEYVVEWAAKDPYGFLTTVILALTPLFLASAVLSWKLAKMIEAREKEQKKKQKRQENIAKAKRLKKD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.96 | -0.956425067256512 | 3.3e-7 | 32071273 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)