Host taxon 10090
Protein NP_598458.1
small integral membrane protein 14
Mus musculus
Gene Smim14, UniProt Q91VT8
>NP_598458.1|Pseudomona aeruginosa PA01|small integral membrane protein 14
MAEGGFDPCECVCSHEHAMRRLINLLRQSQSYCTDTECLRELPGPSSDSGISITVILMAWMVIAMLLFLLRPPNLRGSSLPGKPSSPHSGQDPPAPPVD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.48 | -0.476401379596377 | 0.00094 | 32071273 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)