Host taxon 10090
Protein NP_001129049.1
small integral membrane protein 13
Mus musculus
Gene Smim13, UniProt E9Q942
>NP_001129049.1|Pseudomona aeruginosa PA01|small integral membrane protein 13
MWHNVGLTLLVFVATLLIVLLLMVCGWYFVWHLFLSKFKFLRELVGDTGSQEGDNEQPSGSETEEDPSASPQKIRSARQRRPPVDAGH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.21 | -1.2097311678191 | 6.0e-9 | 32071273 | |
Retrieved 1 of 1 entries in 2.1 ms
(Link to these results)