Host taxon 10090
Protein NP_084528.1
small integral membrane protein 12
Mus musculus
Gene Smim12, UniProt Q78RX3
>NP_084528.1|Pseudomona aeruginosa PA01|small integral membrane protein 12
MWPVLWTVVRTYAPYVTFPVAFVVGAVGYHLEWFIRGKTPQPVEEEKSILERREDRKLDEMLGKDHTQVVSLKDKLEFAPKAVLNRNRPEKN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.09 | -1.09253660579282 | 0.00047 | 32071273 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)