Host taxon 10090
Protein NP_001258512.1
small integral membrane protein 10-like protein 1 isoform 2
Mus musculus
Gene Smim10l1, UniProt A0A087WNQ7
>NP_001258512.1|Pseudomona aeruginosa PA01|small integral membrane protein 10-like protein 1 isoform 2
MGPADAPSALALRAVGPAAATPYGVFCKGLSRTLLAFFELAWQLRMNFPYFYIAGSVILNIRLQGFSGNCCVFQASSRLMISLPSPFDY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.49 | -0.492342263979037 | 1.5e-5 | 32071273 | |
Retrieved 1 of 3 entries in 1.7 ms
(Link to these results)