Host taxon 10090
Protein NP_001157193.1
small integral membrane protein 1
Mus musculus
Gene Smim1, UniProt P0C8K7
>NP_001157193.1|Pseudomona aeruginosa PA01|small integral membrane protein 1
MQSQESGVHYSRWDSSSRDEVSMTAMSSSEEASCYRRISQKLCSGKLGIAMKVLGGVALFWIIFILGYITGYYVHKCK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.24 | -1.24154638138838 | 0.00013 | 32071273 | |
Retrieved 1 of 2 entries in 1.7 ms
(Link to these results)