Host taxon 10090
Protein NP_082161.2
single-strand selective monofunctional uracil DNA glycosylase
Mus musculus
Gene Smug1, UniProt Q6P5C5
>NP_082161.2|Pseudomona aeruginosa PA01|single-strand selective monofunctional uracil DNA glycosylase
MAASQTFPLGPTHEPASALMEPLPCTRSLAEGFLEEELRLNAELSQLQFPEPVGVIYNPVDYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVNVVRDWLGVGGPVLTPPQEHPKRPVLGLECPQSEVSGARFWGFFRTLCGQPQVFFRHCFVHNLCPLLFLAPSGRNLTPAELPAKQREQLLSICDAALCRQVQLLGVRLVVGVGRLAEQRARRALAGLTPEVQVEGLLHPSPRSAQANKGWEAAARERLQELGLLPLLTDEGSARPT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.51 | -1.51397929149497 | 4.4e-5 | 32071273 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)