Host taxon 10090
Protein NP_573477.2
single-pass membrane and coiled-coil domain-containing protein 4
Mus musculus
Gene Smco4, UniProt Q9JIS3
>NP_573477.2|Pseudomona aeruginosa PA01|single-pass membrane and coiled-coil domain-containing protein 4
MRQLKGKPKKETSKDKKERKQAMQEARQQITTVVLPTLAVVVLLIVVFVYVATRPAVTE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ -3.07 | -3.06821122672861 | 1.6e-9 | 32071273 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)