Host taxon 10090
Protein NP_033976.1
signal transducer CD24 precursor
Mus musculus
Gene Cd24a, UniProt Q3THW4
>NP_033976.1|Pseudomona aeruginosa PA01|signal transducer CD24 precursor
MGRAMVARLGLGLLLLALLLPTQIYCNQTSVAPFPGNQNISASPNPSNATTRGGGSSLQSTAGLLALSLSLLHLYC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.75 | 0.747534117291953 | 2.8e-27 | 32071273 | |
Retrieved 1 of 2 entries in 2.2 ms
(Link to these results)