Host taxon 10090
Protein NP_079803.2
signal recognition particle 19 kDa protein
Mus musculus
Gene Srp19, UniProt Q9D104
>NP_079803.2|Pseudomona aeruginosa PA01|signal recognition particle 19 kDa protein
MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNAFLEKNKMYSREWNRDVQFRGRVRVQLKQEDGSLCLVQFPSRKSVMLYVAEMIPKLKTRTQKSGGADPSLQQGEGSKKGKGKKKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.02 | 1.01581012976305 | 0.0013 | 32071273 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)