Host taxon 10090
Protein NP_001273467.1
sigma non-opioid intracellular receptor 1 isoform 2
Mus musculus
Gene Sigmar1, UniProt O55242
>NP_001273467.1|Pseudomona aeruginosa PA01|sigma non-opioid intracellular receptor 1 isoform 2
MPWAAGRRWAWITLILTIIAVLIQAAWLWLGTQNFVFSREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCILHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWKEGTTKSEVFYPAPRTTSHSSIPFGPMPGASGLSLPPTSLAKTPDQPGLKEDLWMDRSAAGPHPSLYSLELIFRQQRIPCRY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.82 | -1.81660700552637 | 2.9e-8 | 32071273 | |
Retrieved 1 of 7 entries in 0.8 ms
(Link to these results)