Host taxon 10090
Protein NP_058594.1
sialomucin core protein 24 precursor
Mus musculus
Gene Cd164, UniProt Q9R0L9
>NP_058594.1|Pseudomona aeruginosa PA01|sialomucin core protein 24 precursor
MSGSSRRLLWAATCLAVLCVSAAQPNITTLAPNVTEVPTTTTKVVPTTQMPTVLPETCASFNSCVSCVNATFTNNITCFWLHCQEANKTYCANEPLSNCSQVNRTDLCSVIPPTTPVPTNSTAKPTTRPSSPTPTPSVVTSAGTTNTTLTPTSQPERKSTFDAASFIGGIVLVLGVQAVIFFLYKFCKSKERNYHTL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.35 | 0.350801950493656 | 2.0e-5 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)